Lineage for d1sfw__ (1sfw -)
- Root: SCOP 1.59
Class a: All alpha proteins [46456] (151 folds) 
Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily) Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families) 
Family a.133.1.2: Vertebrate phospholipase A2 [48623] (4 proteins) Protein Phospholipase A2 [48637] (3 species) 
Species Pig (Sus scrofa), pancreas [TaxId:9823] [48640] (12 PDB entries) 
Domain d1sfw__: 1sfw - [19612]
Details for d1sfw__
PDB Entry: 1sfw (more details)
PDB Description: porcine pancreas phospholipase a2, nmr, 18 structures
SCOP Domain Sequences for d1sfw__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sfw__ a.133.1.2 (-) Phospholipase A2 {Pig (Sus scrofa), pancreas}
alwqfrsmikcaipgshplmdfnnygcycglggsgtpvdeldrccethdncyrdaknlds
ckflvdnpytesysyscsnteitcnsknnaceaficncdrnaaicfskapynkehknldt
kkyc
SCOP Domain Coordinates for d1sfw__:
Click to download the PDB-style file with coordinates for d1sfw__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1sfw__:
- d1sfw__ first appeared (with stable ids) in SCOP 1.55
- d1sfw__ appears in SCOP 1.57
- d1sfw__ appears in SCOP 1.61
- d1sfw__ appears in the current release, SCOPe 2.08, called d1sfwa_
View in 3D