Lineage for d3fh0b1 (3fh0 B:1-141)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2860044Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2861263Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) (S)
    share similar mode of ligand (Adenosine group) binding
    can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group
  5. 2861542Family c.26.2.0: automated matches [191320] (1 protein)
    not a true family
  6. 2861543Protein automated matches [190116] (28 species)
    not a true protein
  7. 2861606Species Klebsiella pneumoniae [TaxId:272620] [193623] (2 PDB entries)
  8. 2861610Domain d3fh0b1: 3fh0 B:1-141 [196115]
    Other proteins in same PDB: d3fh0a2, d3fh0b2
    automated match to d2pfsa_
    complexed with adp, edo

Details for d3fh0b1

PDB Entry: 3fh0 (more details), 2.15 Å

PDB Description: Crystal structure of putative universal stress protein KPN_01444 - ATPase
PDB Compounds: (B:) putative universal stress protein KPN_01444

SCOPe Domain Sequences for d3fh0b1:

Sequence, based on SEQRES records: (download)

>d3fh0b1 c.26.2.0 (B:1-141) automated matches {Klebsiella pneumoniae [TaxId: 272620]}
milvpidisdkefteriishveseariddaevhfltvipslpyyaslgmaytaelpgmde
lregsetqlkeiakkfsipedrmhfhvaegspkdkilalakslpadlviiashrpditty
llgsnaaavvrhaecsvlvvr

Sequence, based on observed residues (ATOM records): (download)

>d3fh0b1 c.26.2.0 (B:1-141) automated matches {Klebsiella pneumoniae [TaxId: 272620]}
milvpidisderiishveseariddaevhfltvipslpgmdelregsetqlkeiakkfsi
pedrmhfhvaegspkdkilalakslpadlviiashrpdittyllgsnaaavvrhaecsvl
vvr

SCOPe Domain Coordinates for d3fh0b1:

Click to download the PDB-style file with coordinates for d3fh0b1.
(The format of our PDB-style files is described here.)

Timeline for d3fh0b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3fh0b2