Lineage for d3pu7b_ (3pu7 B:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1103261Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1110785Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families) (S)
    has additional strand at N-terminus
  5. 1110786Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (3 proteins)
  6. 1111214Protein automated matches [190916] (8 species)
    not a true protein
  7. 1111230Species Solanum lycopersicum [TaxId:4081] [196089] (1 PDB entry)
  8. 1111231Domain d3pu7b_: 3pu7 B: [196090]
    automated match to d1srda_
    complexed with cu, zn

Details for d3pu7b_

PDB Entry: 3pu7 (more details), 1.8 Å

PDB Description: Cu-Zn Tomato Chloroplast Superoxide Dismutase
PDB Compounds: (B:) Superoxide dismutase [Cu-Zn], chloroplastic

SCOPe Domain Sequences for d3pu7b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pu7b_ b.1.8.1 (B:) automated matches {Solanum lycopersicum [TaxId: 4081]}
atkkavavlkgnsnvegvvtlsqdddgpttvnvritglapglhgfhlheygdttngcmst
gahfnpnklthgapgdeirhagdlgnivanadgvaevtlvdnqipltgpnsvvgralvvh
eleddlgkgghelslttgnaggrlacgvvgltpi

SCOPe Domain Coordinates for d3pu7b_:

Click to download the PDB-style file with coordinates for d3pu7b_.
(The format of our PDB-style files is described here.)

Timeline for d3pu7b_: