SCOP 1.59: Domain d2phib_: 2phi B:

Lineage for d2phib_ (2phi B:)

1. Root: SCOP 1.59

2. Class a: All alpha proteins [46456] (151 folds)

3. Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)

4. Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families)

5. Family a.133.1.2: Vertebrate phospholipase A2 [48623] (4 proteins)

6. Protein Phospholipase A2 [48637] (3 species)

7. Species Pig (Sus scrofa), pancreas [TaxId:9823] [48640] (12 PDB entries)

8. Domain d2phib_: 2phi B: [19603]

Details for d2phib_

PDB Entry: 2phi, 2.2 Å

PDB Description: a large conformational change is found in the crystal structure of the porcine pancreatic phospholipase a2 point mutant f63v

SCOP Domain Sequences for d2phib_:

Sequence; same for both SEQRES and ATOM records:

>d2phib_ a.133.1.2 (B:) Phospholipase A2 {Pig (Sus scrofa), pancreas}
alwqfrsmikcaipgshplmdfnnygcycglggsgtpvdeldrccethdncyrdaknlds
ckvlvdnpytesysyscsnteitcnsknnaceaficncdrnaaicfskapynkehknldt
kkyc

Timeline for d2phib_:

• d2phib_ first appeared (with stable ids) in SCOP 1.55
  
• d2phib_ appears in SCOP 1.57
  
• d2phib_ appears in SCOP 1.61
  
• d2phib_ appears in the current release, SCOPe 2.08