Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest |
Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) |
Family c.68.1.9: alpha-1,3-galactosyltransferase-like [64131] (4 proteins) automatically mapped to Pfam PF03414 |
Protein automated matches [190178] (2 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [186910] (75 PDB entries) |
Domain d2y7ab_: 2y7a B: [196020] Other proteins in same PDB: d2y7aa2 automated match to d2rj1a_ complexed with mn, udp |
PDB Entry: 2y7a (more details), 2.06 Å
SCOPe Domain Sequences for d2y7ab_:
Sequence, based on SEQRES records: (download)
>d2y7ab_ c.68.1.9 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} slprmvypqpkvltpcrkdvlvvtpwlapivwegtfnidilneqfrlqnttigltvfaik kyvaflklfletaekhfmvghrvhyyvftdqlaavprvtlgtgrqlsvlevgaykrwqdv smrrmemisdfcerrflsevdylvcvdvdmefrdhvgveiltplfgtlhpsfygssreaf tyerrpqsqayipkdegdfyymgaffggsvqevqrltrachqammvdqangieavwhdes hlnkyllrhkptkvlspeylwdqqllgwpavlrklrftavp
>d2y7ab_ c.68.1.9 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} slprmvypqpkvltpcrkdvlvvtpwlapivwegtfnidilneqfrlqnttigltvfaik kyvaflklfletaekhfmvghrvhyyvftdqlaavprvtlgtgrqlsvlevwqdvsmrrm emisdfcerrflsevdylvcvdvdmefrdhvgveiltplfgtlhpsfygssreaftyerr pqsqayipkdegdfyymgaffggsvqevqrltrachqammvdqangieavwhdeshlnky llrhkptkvlspeylwdqqllgwpavlrklrftavp
Timeline for d2y7ab_:
View in 3D Domains from other chains: (mouse over for more information) d2y7aa1, d2y7aa2, d2y7ac_, d2y7ad_ |