Lineage for d3az9n_ (3az9 N:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1646047Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 1646048Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) (S)
  5. 1646506Family d.38.1.6: FabZ-like [110902] (1 protein)
    automatically mapped to Pfam PF07977
  6. 1646507Protein (3R)-hydroxymyristoyl ACP dehydrase FabZ [110903] (3 species)
  7. 1646605Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [143186] (8 PDB entries)
    Uniprot Q965D7 84-229! Uniprot Q965D7 94-229
  8. 1646675Domain d3az9n_: 3az9 N: [195974]
    automated match to d1z6bf_
    complexed with gol, k91, po4

Details for d3az9n_

PDB Entry: 3az9 (more details), 2.75 Å

PDB Description: Beta-Hydroxyacyl-Acyl Carrier Protein Dehydratase (FabZ) from Plasmodium falciparum in complex with NAS91
PDB Compounds: (N:) Beta-hydroxyacyl-ACP dehydratase

SCOPe Domain Sequences for d3az9n_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3az9n_ d.38.1.6 (N:) (3R)-hydroxymyristoyl ACP dehydrase FabZ {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
tsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpqkqimpgvl
qiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanlisfksslgi
aklsgvgyvngkvvinisemtfals

SCOPe Domain Coordinates for d3az9n_:

Click to download the PDB-style file with coordinates for d3az9n_.
(The format of our PDB-style files is described here.)

Timeline for d3az9n_: