Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families) |
Family c.66.1.44: TehB-like [142603] (2 proteins) Pfam PF03848; overall structural similarity to Thiopurine S-methyltransferase (Pfam PF05724) |
Protein automated matches [191226] (3 species) not a true protein |
Species Escherichia coli [TaxId:562] [189643] (2 PDB entries) |
Domain d4dq0b_: 4dq0 B: [195957] automated match to d2xvma_ complexed with nhe |
PDB Entry: 4dq0 (more details), 2.2 Å
SCOPe Domain Sequences for d4dq0b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4dq0b_ c.66.1.44 (B:) automated matches {Escherichia coli [TaxId: 562]} amiirdenyftdkyeltrthsevleavkvvkpgktldlgcgngrnslylaangydvdawd knamsianveriksienldnlhtrvvdlnnltfdgeydfilstvvlmfleaktipglian mqrctkpggynlivaamdtadypctvgfpfafkegelrryyegwemvkynedvgelhrtd angnriklrfatmlarkk
Timeline for d4dq0b_: