SCOPe 2.05: Domain d4dq0d_: 4dq0 D:

Lineage for d4dq0d_ (4dq0 D:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families)

5. Family c.66.1.44: TehB-like [142603] (2 proteins)
   Pfam PF03848; overall structural similarity to Thiopurine S-methyltransferase (Pfam PF05724)

6. Protein automated matches [191226] (3 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [189643] (2 PDB entries)

8. Domain d4dq0d_: 4dq0 D: [201726]
   automated match to d4dq0c_
   complexed with nhe

Details for d4dq0d_

PDB Entry: 4dq0, 2.2 Å

PDB Description: The crystal structure of tellurite resistance protein from Escherichia coli O157:H7 str. Sakai

PDB Compounds: (D:) Tellurite resistance protein

SCOPe Domain Sequences for d4dq0d_:

Sequence, based on SEQRES records:

>d4dq0d_ c.66.1.44 (D:) automated matches {Escherichia coli [TaxId: 562]}
iirdenyftdkyeltrthsevleavkvvkpgktldlgcgngrnslylaangydvdawdkn
amsianveriksienldnlhtrvvdlnnltfdgeydfilstvvlmfleaktipglianmq
rctkpggynlivaamdtadypctvgfpfafkegelrryyegwemvkynedvgelhrtdan
gnriklrfatmlarkk

Sequence, based on observed residues (ATOM records):

>d4dq0d_ c.66.1.44 (D:) automated matches {Escherichia coli [TaxId: 562]}
iirdenyftdkyeltrthsevleavkvvkpgktldlgcgngrnslylaangydvdawdkn
amsianveriksienldnlhtrvvdlnnltfdgeydfilstvvlmfleaktipglianmq
rctkpggynlivaamdtadypctvgfpfafkegelrryyegwemvkynedvgelhrtgnr
iklrfatmlarkk

Timeline for d4dq0d_:

• d4dq0d_ first appeared in SCOPe 2.03
  
• d4dq0d_ appears in SCOPe 2.04
  
• d4dq0d_ appears in SCOPe 2.06
  
• d4dq0d_ appears in the current release, SCOPe 2.08