Lineage for d1bpq__ (1bpq -)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 101410Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
  4. 101411Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families) (S)
  5. 101416Family a.133.1.2: Vertebrate phospholipase A2 [48623] (4 proteins)
  6. 101429Protein Phospholipase A2 [48637] (3 species)
  7. 101430Species Cow (Bos taurus), pancreas [TaxId:9913] [48639] (21 PDB entries)
  8. 101437Domain d1bpq__: 1bpq - [19588]

Details for d1bpq__

PDB Entry: 1bpq (more details), 1.8 Å

PDB Description: phospholipase a2 engineering. x-ray structural and functional evidence for the interaction of lysine-56 with substrates

SCOP Domain Sequences for d1bpq__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bpq__ a.133.1.2 (-) Phospholipase A2 {Cow (Bos taurus), pancreas}
alwqfngmikckipsseplldfnnygcycglggsgtpvddldrccqthdncykqamklds
ckvlvdnpytnnysyscsnneitcssennaceaficncdrnaaicfskvpynkehknldk
knc

SCOP Domain Coordinates for d1bpq__:

Click to download the PDB-style file with coordinates for d1bpq__.
(The format of our PDB-style files is described here.)

Timeline for d1bpq__: