SCOPe 2.04: Domain d3t1ua_: 3t1u A:

Lineage for d3t1ua_ (3t1u A:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.62: Cyclophilin-like [50890] (1 superfamily)
   barrel, closed; n=8, S=10; complex topology

4. Superfamily b.62.1: Cyclophilin-like [50891] (5 families)

5. Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins)
   automatically mapped to Pfam PF00160

6. Protein automated matches [190077] (17 species)
   not a true protein

7. Species Azotobacter vinelandii [TaxId:322710] [195875] (1 PDB entry)

8. Domain d3t1ua_: 3t1u A: [195876]
   automated match to d3s6ma_

Details for d3t1ua_

PDB Entry: 3t1u, 2 Å

PDB Description: crystal structure of the complex of cyclophilin-a enzyme from azotobacter vinelandii with sucafpfpna peptide

PDB Compounds: (A:) peptidyl-prolyl cis-trans isomerase

SCOPe Domain Sequences for d3t1ua_:

Sequence; same for both SEQRES and ATOM records:

>d3t1ua_ b.62.1.1 (A:) automated matches {Azotobacter vinelandii [TaxId: 322710]}
siklqtnhgtitlklfadkapetaanfeqyvkdghydgtifhrvidgfmiqgggfepgmk
qkstrapikneannglsnkkytiamartpdphsasaqffinvkdnafldhtaptahgwgy
avfgevvegtdvvdriksvatgsraghgdvpvddviiekaeiv

Timeline for d3t1ua_:

• d3t1ua_ first appeared in SCOPe 2.02
  
• d3t1ua_ appears in SCOPe 2.03
  
• d3t1ua_ appears in SCOPe 2.05
  
• d3t1ua_ appears in the current release, SCOPe 2.08, called d3t1ua1