![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.17: Caspase-like [52128] (1 superfamily) 3 layers, a/b/a; core: mixed beta-sheet of 6 strands, order 213456, strand 6 is antiparallel to the rest |
![]() | Superfamily c.17.1: Caspase-like [52129] (3 families) ![]() mature protein may be composed of two chains folded in a single domain |
![]() | Family c.17.1.0: automated matches [191651] (1 protein) not a true family |
![]() | Protein automated matches [191201] (1 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [189525] (14 PDB entries) |
![]() | Domain d3v6lb_: 3v6l B: [195683] automated match to d3od5a_ mutant |
PDB Entry: 3v6l (more details), 2.2 Å
SCOPe Domain Sequences for d3v6lb_:
Sequence, based on SEQRES records: (download)
>d3v6lb_ c.17.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} mfdpaekykmdhrrrgialifnherffwhltlperrgtcadrdnltrrfsdlgfevkcfn dlkaeelllkihevstvshadadcfvcvflshgegnhiyaydakieiqtltglfkgdkch slvgkpkifiiqacrgnqhdvpvipldvvdnqtekldtnitevdaasvytlpagadflmc ysvaegyyshretvngswyiqdlcemlgkygssleftelltlvnrkveqrrvdfckdpsa igkkqvpcfasmltkklhffpks
>d3v6lb_ c.17.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} mfdpaekykmdhrrrgialifnherffwhltlperrgtcadrdnltrrfsdlgfevkcfn dlkaeelllkihevstvshadadcfvcvflshgegnhiyaydakieiqtltglfkgdkch slvgkpkifiiqacrgntnitevdaasvytlpagadflmcysvaegyyshretvngswyi qdlcemlgkygssleftelltlvnrkveqrrvdkdpsaigkkqvpcfasmltkklhffpk s
Timeline for d3v6lb_: