Lineage for d3axkt_ (3axk T:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1208801Fold d.73: RuBisCO, small subunit [55238] (1 superfamily)
    alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta
  4. 1208802Superfamily d.73.1: RuBisCO, small subunit [55239] (1 family) (S)
  5. 1208803Family d.73.1.1: RuBisCO, small subunit [55240] (2 proteins)
  6. 1208961Protein automated matches [190066] (5 species)
    not a true protein
  7. 1209021Species Oryza sativa [TaxId:39947] [195635] (2 PDB entries)
  8. 1209027Domain d3axkt_: 3axk T: [195638]
    automated match to d1wdds_
    complexed with gol, mg, ndp

Details for d3axkt_

PDB Entry: 3axk (more details), 1.9 Å

PDB Description: Structure of rice Rubisco in complex with NADP(H)
PDB Compounds: (T:) Ribulose bisphosphate carboxylase small chain, chloroplastic

SCOPe Domain Sequences for d3axkt_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3axkt_ d.73.1.1 (T:) automated matches {Oryza sativa [TaxId: 39947]}
xmqvwpiegikkfetlsylppltvedllkqieyllrskwvpclefskvgfvyrenhrspg
yydgrywtmwklpmfgctdatqvlkeleeakkaypdafvriigfdnvrqvqcisfiaykp

SCOPe Domain Coordinates for d3axkt_:

Click to download the PDB-style file with coordinates for d3axkt_.
(The format of our PDB-style files is described here.)

Timeline for d3axkt_: