Class b: All beta proteins [48724] (180 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins) |
Protein Coagulation factor XI [117237] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [117238] (59 PDB entries) Uniprot P03951 388-624 |
Domain d3sosa_: 3sos A: [195609] automated match to d3bg8a_ complexed with cit, o61, trs |
PDB Entry: 3sos (more details), 2.58 Å
SCOPe Domain Sequences for d3sosa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3sosa_ b.47.1.2 (A:) Coagulation factor XI {Human (Homo sapiens) [TaxId: 9606]} ivggtasvrgewpwqvtlhttsptqrhlcggsiignqwiltaahcfygvespkilrvysg ilnqseikedtsffgvqeiiihdqykmaesgydiallklettvnytdsqrpislpskgdr nviytdcwvtgwgyrklrdkiqntlqkakiplvtneecqkryrghkithkmicagyregg kdackgdsggplsckhnevwhlvgitswgegcaqrerpgvytnvveyvdwilektq
Timeline for d3sosa_: