Lineage for d3vjca_ (3vjc A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2014347Fold a.128: Terpenoid synthases [48575] (1 superfamily)
    multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers
  4. 2014348Superfamily a.128.1: Terpenoid synthases [48576] (6 families) (S)
    duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J
  5. 2014483Family a.128.1.2: Squalene synthase [48580] (2 proteins)
    automatically mapped to Pfam PF00494
  6. 2014489Protein automated matches [191305] (1 species)
    not a true protein
  7. 2014490Species Human (Homo sapiens) [TaxId:9606] [190011] (24 PDB entries)
  8. 2014495Domain d3vjca_: 3vjc A: [195594]
    automated match to d1ezfb_
    complexed with mg, po4, zga

Details for d3vjca_

PDB Entry: 3vjc (more details), 1.89 Å

PDB Description: Crystal structure of the human squalene synthase in complex with zaragozic acid A
PDB Compounds: (A:) Squalene synthase

SCOPe Domain Sequences for d3vjca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vjca_ a.128.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lssslktcykylnqtsrsfaaviqaldgemrnavcifylvlraldtleddmtisvekkvp
llhnfhsflyqpdwrfmeskekdrqvledfptislefrnlaekyqtviadicrrmgigma
efldkhvtseqewdkychyvaglvgiglsrlfsasefedplvgedteransmglflqktn
iirdyledqqggrefwpqevwsryvkklgdfakpenidlavqclnelitnalhhipdvit
ylsrlrnqsvfnfcaipqvmaiatlaacynnqqvfkgavkirkgqavtlmmdatnmpavk
aiiyqymeeiyhripdsdpsssktrqiistirtq

SCOPe Domain Coordinates for d3vjca_:

Click to download the PDB-style file with coordinates for d3vjca_.
(The format of our PDB-style files is described here.)

Timeline for d3vjca_: