SCOPe 2.07: Domain d4egub1: 4egu B:4-115

Lineage for d4egub1 (4egu B:4-115)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.13: HIT-like [54196] (2 superfamilies)
   alpha-beta(3)-alpha-beta(2); 3 layers: alpha/beta/alpha

4. Superfamily d.13.1: HIT-like [54197] (6 families)

5. Family d.13.1.0: automated matches [191614] (1 protein)
   not a true family

6. Protein automated matches [191122] (10 species)
   not a true protein

7. Species Clostridium difficile [TaxId:272563] [195574] (1 PDB entry)

8. Domain d4egub1: 4egu B:4-115 [195576]
   Other proteins in same PDB: d4egua2, d4egub2
   automated match to d3oxka_
   complexed with 5gp, k, zn

Details for d4egub1

PDB Entry: 4egu, 0.95 Å

PDB Description: 0.95A Resolution Structure of a Histidine Triad Protein from Clostridium difficile

PDB Compounds: (B:) Histidine triad (HIT) protein

SCOPe Domain Sequences for d4egub1:

Sequence; same for both SEQRES and ATOM records:

>d4egub1 d.13.1.0 (B:4-115) automated matches {Clostridium difficile [TaxId: 272563]}
mdcifckiangeipstkvyeddrvlafndlnpvapyhilvvpkkhydslidipdkemdiv
shihvvinkiakekgfdqtgfrvinncgsdggqevkhlhyhilagkklpnye

Timeline for d4egub1:

• d4egub1 first appeared in SCOPe 2.02, called d4egub_
  
• d4egub1 appears in SCOPe 2.06
  
• d4egub1 appears in the current release, SCOPe 2.08