![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest |
![]() | Superfamily c.52.1: Restriction endonuclease-like [52980] (35 families) ![]() |
![]() | Family c.52.1.7: Cfr10I/Bse634I [52999] (2 proteins) automatically mapped to Pfam PF07832 |
![]() | Protein Restriction endonuclease Bse634I [69523] (1 species) |
![]() | Species Bacillus stearothermophilus [TaxId:1422] [69524] (4 PDB entries) |
![]() | Domain d3v21b_: 3v21 B: [195493] automated match to d1knvb_ protein/DNA complex |
PDB Entry: 3v21 (more details), 2.7 Å
SCOPe Domain Sequences for d3v21b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3v21b_ c.52.1.7 (B:) Restriction endonuclease Bse634I {Bacillus stearothermophilus [TaxId: 1422]} nltnsncveeykengktkirikpfnalielyhhqtptgsikenldklenyvkdvvkakgl aiptsgafsntrgtwfevmiaiqswnyrvkrelndyliikmpnvktfdfrkifdnetrek lhqleksllthkqqvrlitsnpdlliirqkdlikseynlpinklthenidvaltlfkdie gkckwdslvagvglktslrpdrrlqlvhegnilkslfahlkmaywnpkaefkyygassep vskadddalqtaathtivnvnstperavddifsltsfedidkmldqiik
Timeline for d3v21b_: