Lineage for d4eqea_ (4eqe A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2536878Fold d.13: HIT-like [54196] (2 superfamilies)
    alpha-beta(3)-alpha-beta(2); 3 layers: alpha/beta/alpha
  4. 2536879Superfamily d.13.1: HIT-like [54197] (6 families) (S)
  5. 2536880Family d.13.1.1: HIT (HINT, histidine triad) family of protein kinase-interacting proteins [54198] (8 proteins)
    Pfam PF01230
    topologically similar to the N-terminal domain of protein kinases
  6. 2536891Protein Histidine triad nucleotide-binding protein (HINT) [54199] (2 species)
  7. 2536892Species Human (Homo sapiens) [TaxId:9606] [224916] (19 PDB entries)
  8. 2536911Domain d4eqea_: 4eqe A: [195461]
    automated match to d3tw2a_
    complexed with epe, kaa

Details for d4eqea_

PDB Entry: 4eqe (more details), 1.52 Å

PDB Description: crystal structure of histidine triad nucleotide-binding protein 1 (hint1) from human complexed with lys-ams
PDB Compounds: (A:) Histidine triad nucleotide-binding protein 1

SCOPe Domain Sequences for d4eqea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4eqea_ d.13.1.1 (A:) Histidine triad nucleotide-binding protein (HINT) {Human (Homo sapiens) [TaxId: 9606]}
pggdtifgkiirkeipakiifeddrclafhdispqapthflvipkkhisqisvaedddes
llghlmivgkkcaadlglnkgyrmvvnegsdggqsvyhvhlhvlggrqmhwppg

SCOPe Domain Coordinates for d4eqea_:

Click to download the PDB-style file with coordinates for d4eqea_.
(The format of our PDB-style files is described here.)

Timeline for d4eqea_: