SCOPe 2.05: Domain d1b4wb_: 1b4w B:

Lineage for d1b4wb_ (1b4w B:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
   common core: 2 helices, disulfide-linked, and a calcium-binding loop

4. Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families)

5. Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
   automatically mapped to Pfam PF00068

6. Protein Snake phospholipase A2 [48624] (36 species)

7. Species Halys viper (Agkistrodon halys) [TaxId:8714] [48628] (9 PDB entries)

8. Domain d1b4wb_: 1b4w B: [19537]
   complexed with bog

Details for d1b4wb_

PDB Entry: 1b4w, 2.6 Å

PDB Description: basic phospholipase a2 from agkistrodon halys pallas-implications for its association and anticoagulant activities by x-ray crystallography

PDB Compounds: (B:) protein (phospholipase a2)

SCOPe Domain Sequences for d1b4wb_:

Sequence; same for both SEQRES and ATOM records:

>d1b4wb_ a.133.1.2 (B:) Snake phospholipase A2 {Halys viper (Agkistrodon halys) [TaxId: 8714]}
hllqfrkmikkmtgkepvvsyafygcycgsggrgkpkdatdrccfvhdccyekvtgcdpk
wddytyswkngtivcggddpckkevcecdkaaaicfrdnlktykkrymaypdilcsskse
kc

Timeline for d1b4wb_:

• d1b4wb_ first appeared (with stable ids) in SCOP 1.55
  
• d1b4wb_ appears in SCOPe 2.04
  
• d1b4wb_ appears in SCOPe 2.06
  
• d1b4wb_ appears in the current release, SCOPe 2.08