Lineage for d1bjjf_ (1bjj F:)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 156745Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
  4. 156746Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families) (S)
  5. 156751Family a.133.1.2: Vertebrate phospholipase A2 [48623] (2 proteins)
  6. 156820Protein Snake phospholipase A2 [48624] (18 species)
  7. 156826Species Chinese water moccasin (Agkistrodon halys pallas), different isoforms [48628] (7 PDB entries)
  8. 156840Domain d1bjjf_: 1bjj F: [19535]

Details for d1bjjf_

PDB Entry: 1bjj (more details), 2.8 Å

PDB Description: agkistrodotoxin, a phospholipase a2-type presynaptic neurotoxin from agkistrodon halys pallas

SCOP Domain Sequences for d1bjjf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bjjf_ a.133.1.2 (F:) Snake phospholipase A2 {Chinese water moccasin (Agkistrodon halys pallas), different isoforms}
nllqfnkmikeetgknaipfyafygcycgwggqgkpkdgtdrccfvhdccygrlvncntk
sdiysyslkegyitcgkgtnceeqicecdrvaaecfrrnldtynngymfyrdskctetse
ec

SCOP Domain Coordinates for d1bjjf_:

Click to download the PDB-style file with coordinates for d1bjjf_.
(The format of our PDB-style files is described here.)

Timeline for d1bjjf_: