SCOPe 2.06: Domain d4epxa1: 4epx A:1-169

Lineage for d4epxa1 (4epx A:1-169)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein automated matches [190047] (29 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186768] (179 PDB entries)

8. Domain d4epxa1: 4epx A:1-169 [195333]
   Other proteins in same PDB: d4epxa2
   automated match to d3gftb_
   complexed with 0qr, gdp, mg

Details for d4epxa1

PDB Entry: 4epx, 1.76 Å

PDB Description: Discovery of Small Molecules that Bind to K-Ras and Inhibit Sos-mediated Activation

PDB Compounds: (A:) GTPase KRas

SCOPe Domain Sequences for d4epxa1:

Sequence; same for both SEQRES and ATOM records:

>d4epxa1 c.37.1.8 (A:1-169) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mteyklvvvgavgvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtag
qeeysamrdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnksdl
psrtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhkek

Timeline for d4epxa1:

• d4epxa1 first appeared in SCOPe 2.02, called d4epxa_
  
• d4epxa1 was called d4epxa_ in SCOPe 2.05
  
• d4epxa1 appears in SCOPe 2.07
  
• d4epxa1 appears in the current release, SCOPe 2.08