Lineage for d4faka_ (4fak A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1884654Fold c.116: alpha/beta knot [75216] (1 superfamily)
    core: 3 layers: a/b/a, parallel beta-sheet of 5 strands, order 21435; contains a deep trefoil knot
  4. 1884655Superfamily c.116.1: alpha/beta knot [75217] (9 families) (S)
    known or predicted SAM-dependent methytransferases including the SPOUT 'sequence' superfamily
    all known members have dimeric structures
  5. 1884689Family c.116.1.3: YbeA-like [82371] (5 proteins)
    Pfam PF02590
  6. 1884715Protein automated matches [195222] (1 species)
    not a true protein
  7. 1884716Species Staphylococcus aureus [TaxId:1280] [195223] (1 PDB entry)
  8. 1884717Domain d4faka_: 4fak A: [195224]
    automated match to d1vh0a_
    protein/RNA complex; complexed with pg4, po4, sam

Details for d4faka_

PDB Entry: 4fak (more details), 1.7 Å

PDB Description: Crystal Structure of OrfX in Complex with S-Adenosylmethionine
PDB Compounds: (A:) Ribosomal RNA large subunit methyltransferase H

SCOPe Domain Sequences for d4faka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4faka_ c.116.1.3 (A:) automated matches {Staphylococcus aureus [TaxId: 1280]}
aaefmkitilavgklkekywkqaiaeyekrlgpytkidiievpdekapenmsdkeieqvk
ekegqrilakikpqstvitleiqgkmlsseglaqelnqrmtqgqsdfvfviggsnglhkd
vlqrsnyalsfskmtfphqmmrvvlieqvyrafkimrgeayhk

SCOPe Domain Coordinates for d4faka_:

Click to download the PDB-style file with coordinates for d4faka_.
(The format of our PDB-style files is described here.)

Timeline for d4faka_: