Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.116: alpha/beta knot [75216] (1 superfamily) core: 3 layers: a/b/a, parallel beta-sheet of 5 strands, order 21435; contains a deep trefoil knot |
Superfamily c.116.1: alpha/beta knot [75217] (9 families) known or predicted SAM-dependent methytransferases including the SPOUT 'sequence' superfamily all known members have dimeric structures |
Family c.116.1.3: YbeA-like [82371] (5 proteins) Pfam PF02590 |
Protein automated matches [195222] (2 species) not a true protein |
Species Staphylococcus aureus [TaxId:1280] [195223] (1 PDB entry) |
Domain d4faka1: 4fak A:1-159 [195224] Other proteins in same PDB: d4faka2 automated match to d1vh0a_ protein/RNA complex; complexed with pg4, po4, sam |
PDB Entry: 4fak (more details), 1.7 Å
SCOPe Domain Sequences for d4faka1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4faka1 c.116.1.3 (A:1-159) automated matches {Staphylococcus aureus [TaxId: 1280]} mkitilavgklkekywkqaiaeyekrlgpytkidiievpdekapenmsdkeieqvkekeg qrilakikpqstvitleiqgkmlsseglaqelnqrmtqgqsdfvfviggsnglhkdvlqr snyalsfskmtfphqmmrvvlieqvyrafkimrgeayhk
Timeline for d4faka1: