Lineage for d4faka1 (4fak A:1-159)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2921212Fold c.116: alpha/beta knot [75216] (1 superfamily)
    core: 3 layers: a/b/a, parallel beta-sheet of 5 strands, order 21435; contains a deep trefoil knot
  4. 2921213Superfamily c.116.1: alpha/beta knot [75217] (9 families) (S)
    known or predicted SAM-dependent methytransferases including the SPOUT 'sequence' superfamily
    all known members have dimeric structures
  5. 2921250Family c.116.1.3: YbeA-like [82371] (5 proteins)
    Pfam PF02590
  6. 2921276Protein automated matches [195222] (2 species)
    not a true protein
  7. 2921286Species Staphylococcus aureus [TaxId:1280] [195223] (1 PDB entry)
  8. 2921287Domain d4faka1: 4fak A:1-159 [195224]
    Other proteins in same PDB: d4faka2
    automated match to d1vh0a_
    protein/RNA complex; complexed with pg4, po4, sam

Details for d4faka1

PDB Entry: 4fak (more details), 1.7 Å

PDB Description: Crystal Structure of OrfX in Complex with S-Adenosylmethionine
PDB Compounds: (A:) Ribosomal RNA large subunit methyltransferase H

SCOPe Domain Sequences for d4faka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4faka1 c.116.1.3 (A:1-159) automated matches {Staphylococcus aureus [TaxId: 1280]}
mkitilavgklkekywkqaiaeyekrlgpytkidiievpdekapenmsdkeieqvkekeg
qrilakikpqstvitleiqgkmlsseglaqelnqrmtqgqsdfvfviggsnglhkdvlqr
snyalsfskmtfphqmmrvvlieqvyrafkimrgeayhk

SCOPe Domain Coordinates for d4faka1:

Click to download the PDB-style file with coordinates for d4faka1.
(The format of our PDB-style files is described here.)

Timeline for d4faka1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4faka2