SCOPe 2.07: Domain d3b0ka1: 3b0k A:2-120

Lineage for d3b0ka1 (3b0k A:2-120)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (12 families)

5. Family d.2.1.2: C-type lysozyme [53960] (3 proteins)
   automatically mapped to Pfam PF00062

6. Protein alpha-Lactalbumin [53975] (6 species)
   expressed only in the lactating mammary gland, strongly binds calcium ion

7. Species Goat (Capra hircus) [TaxId:9925] [53979] (5 PDB entries)

8. Domain d3b0ka1: 3b0k A:2-120 [195187]
   Other proteins in same PDB: d3b0ka2, d3b0kb2
   automated match to d1fkqa_
   complexed with ca

Details for d3b0ka1

PDB Entry: 3b0k, 1.6 Å

PDB Description: Crystal structure of alpha-lactalbumin

PDB Compounds: (A:) alpha-lactalbumin

SCOPe Domain Sequences for d3b0ka1:

Sequence; same for both SEQRES and ATOM records:

>d3b0ka1 d.2.1.2 (A:2-120) alpha-Lactalbumin {Goat (Capra hircus) [TaxId: 9925]}
qltkcevfqklkdlkdyggvslpewvctafhtsgydtqaivqnndsteyglfqinnkiwc
kddqnphsrnicniscdkfldddltddivcakkildkvginywlahkalcsekldqwlc

Timeline for d3b0ka1:

• d3b0ka1 first appeared in SCOPe 2.02, called d3b0ka_
  
• d3b0ka1 appears in SCOPe 2.06
  
• d3b0ka1 appears in the current release, SCOPe 2.08