SCOPe 2.03: Domain d4emka_: 4emk A:

Lineage for d4emka_ (4emk A:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.38: Sm-like fold [50181] (5 superfamilies)
   core: barrel, open; n*=4, S*=8; meander; SH3-like topology

4. Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families)

5. Family b.38.1.0: automated matches [191538] (1 protein)
   not a true family

6. Protein automated matches [190914] (7 species)
   not a true protein

7. Species Schizosaccharomyces pombe [TaxId:284812] [189773] (4 PDB entries)

8. Domain d4emka_: 4emk A: [195160]
   automated match to d3swna_

Details for d4emka_

PDB Entry: 4emk, 2.3 Å

PDB Description: Crystal structure of SpLsm5/6/7

PDB Compounds: (A:) U6 snRNA-associated Sm-like protein LSm5

SCOPe Domain Sequences for d4emka_:

Sequence; same for both SEQRES and ATOM records:

>d4emka_ b.38.1.0 (A:) automated matches {Schizosaccharomyces pombe [TaxId: 284812]}
lplelidkcigsnlwvimkserefagtlvgfddyvnivlkdvteydtvtgvtekhsemll
ngngmcmlipgg

Timeline for d4emka_:

• d4emka_ first appeared in SCOPe 2.02
  
• d4emka_ appears in SCOPe 2.04
  
• d4emka_ appears in the current release, SCOPe 2.08