SCOPe 2.02: Domain d4dj8a_: 4dj8 A:

Lineage for d4dj8a_ (4dj8 A:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.19: Viral protein domain [49817] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll; form trimers

4. Superfamily b.19.1: Viral protein domain [49818] (3 families)
   forms homotrimers

5. Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)

6. Protein automated matches [190291] (11 species)
   not a true protein

7. Species Influenza a virus (a/netherlands/219/2003(h7n7)) [TaxId:680693] [195111] (1 PDB entry)

8. Domain d4dj8a_: 4dj8 A: [195113]
   automated match to d1ti8a1
   complexed with nag, sia

Details for d4dj8a_

PDB Entry: 4dj8, 2.8 Å

PDB Description: structure of the hemagglutinin complexed with 6sln from a highly pathogenic h7n7 influenza virus

PDB Compounds: (A:) Hemagglutinin

SCOPe Domain Sequences for d4dj8a_:

Sequence; same for both SEQRES and ATOM records:

>d4dj8a_ b.19.1.2 (A:) automated matches {Influenza a virus (a/netherlands/219/2003(h7n7)) [TaxId: 680693]}
dkiclghhavsngtkvntltergvevvnatetvertnvpricskgkrtvdlgqcgllgti
tgppqcdqflefsadliierregsdvcypgkfvneealrqilresggidketmgftysgi
rtngttsacrrsgssfyaemkwllsntdnaafpqmtksykntrkdpaliiwgihhsgstt
eqtklygsgnklitvgssnyqqsfvpspgarpqvngqsgridfhwlilnpndtvtfsfng
afiapdrasflrgksmgiqsevqvdancegdcyhsggtiisnlpfqninsravgkcpryv
kqeslllatgmknvpe

Timeline for d4dj8a_:

• d4dj8a_ is new in SCOPe 2.02-stable
  
• d4dj8a_ appears in SCOPe 2.03
  
• d4dj8a_ appears in the current release, SCOPe 2.08