Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.0: automated matches [191314] (1 protein) not a true family |
Protein automated matches [190075] (60 species) not a true protein |
Species Neotermes koshunensis [TaxId:60586] [189411] (13 PDB entries) |
Domain d3vima_: 3vim A: [194991] automated match to d3ahza_ complexed with cl, gbh, gol, na |
PDB Entry: 3vim (more details), 1.03 Å
SCOPe Domain Sequences for d3vima_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3vima_ c.1.8.0 (A:) automated matches {Neotermes koshunensis [TaxId: 60586]} tvytfpdefklgaatasyqiegawdengkgpniwdtlthehpdyvvdgatgdiaddsyhl ykedvkilkelgaqvyrfsiswarvlpeghdnivnqdgidyynnlinellangiepmvtm yhwdlpqalqdlggwpnlvlakysenyarvlfknfgdrvklwltfndpltfmdgyaseig mapsintpgigdylaahtvihahariyhlydqefraeqggkvgislninwcepatnsaed rascenyqqfnlglyahpifteegdypavlkdrvsrnsadegytdsrlpqftaeeveyir gthdflginfytallgksgvegyepsryrdsgviltqdaawpisasswlkvvpwgfrkel nwikneynnppvfitengfsdygglndtgrvhyytehlkemlkaihedgvnvigytawsl mdnfewlrgysekfgiyavdfedparpripkesakvlaeimntrkiperfrd
Timeline for d3vima_: