Class a: All alpha proteins [46456] (289 folds) |
Fold a.104: Cytochrome P450 [48263] (1 superfamily) multihelical |
Superfamily a.104.1: Cytochrome P450 [48264] (2 families) |
Family a.104.1.0: automated matches [191509] (1 protein) not a true family |
Protein automated matches [190847] (95 species) not a true protein |
Species Streptomyces coelicolor [TaxId:1902] [194965] (1 PDB entry) |
Domain d3tywb1: 3tyw B:17-411 [194966] Other proteins in same PDB: d3tywa2, d3tywb2, d3tywc2, d3tywd2 automated match to d2zbxa_ complexed with hem |
PDB Entry: 3tyw (more details), 2.9 Å
SCOPe Domain Sequences for d3tywb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3tywb1 a.104.1.0 (B:17-411) automated matches {Streptomyces coelicolor [TaxId: 1902]} pprdfpiqrgcpfaapaeyaalrtddpvarvtlptrreawvvtryddvrellsdprvsad irrpgfpalgegeqeagarfrpfirtdapehtryrrmllpaftvrrvramrpavqarvde ildgmlaaggpvdlvsayanavstsvicellgiprhdleffrdvtrisgsrnstaeqvse algglfgllgglvaerreeprddlisklvtdhlvpgnvtteqllstlgitinagrettts mialstlllldrpelpaelrkdpdlmpaavdellrvlsvadsiplrvaaedielsgrtvp addgviallaganhdpeqfddpervdfhrtdnhhvafgygvhqcvgqhlarlelevalet llrrvptlrlagerdqvvvkhdsatfgleelmvtw
Timeline for d3tywb1: