Lineage for d3zs3a_ (3zs3 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2777878Fold b.25: Osmotin, thaumatin-like protein [49869] (1 superfamily)
    sandwich; 11 strands in 2 sheets
  4. 2777879Superfamily b.25.1: Osmotin, thaumatin-like protein [49870] (2 families) (S)
    has two smaller insertion domains
  5. 2778056Family b.25.1.0: automated matches [191382] (1 protein)
    not a true family
  6. 2778057Protein automated matches [190478] (3 species)
    not a true protein
  7. 2778058Species Malus x [TaxId:3750] [194955] (1 PDB entry)
  8. 2778059Domain d3zs3a_: 3zs3 A: [194956]
    automated match to d2ahna_
    complexed with act, acy, fmt, sin

Details for d3zs3a_

PDB Entry: 3zs3 (more details), 1.8 Å

PDB Description: high resolution structure of mal d 2, the thaumatin like food allergen from apple
PDB Compounds: (A:) Thaumatin-like protein

SCOPe Domain Sequences for d3zs3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zs3a_ b.25.1.0 (A:) automated matches {Malus x [TaxId: 3750]}
akitftnncpntvwpgtltgdqkpqlsltgfelaskasrsvdapspwsgrfwgrtrcstd
aagkftcetadcgsgqvacngagavppatlveitiaanggqdyydvslvdgfnlpmsvap
qggtgeckpsscpanvnkvcpaplqvkaadgsviscksaclafgdskycctppnntpetc
ppteyseifekqcpqaysyayddknstftcsggpdyvitfcp

SCOPe Domain Coordinates for d3zs3a_:

Click to download the PDB-style file with coordinates for d3zs3a_.
(The format of our PDB-style files is described here.)

Timeline for d3zs3a_: