PDB entry 3zs3

View 3zs3 on RCSB PDB site
Description: High resolution structure of Mal d 2, the thaumatin like food allergen from apple
Class: allergen
Keywords: allergen
Deposited on 2011-06-22, released 2012-07-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-07-17, with a file datestamp of 2019-07-12.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thaumatin-like protein
    Species: MALUS X DOMESTICA [TaxId:3750]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3zs3a_
  • Heterogens: SIN, ACT, FMT, ACY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3zs3A (A:)
akitftnncpntvwpgtltgdqkpqlsltgfelaskasrsvdapspwsgrfwgrtrcstd
aagkftcetadcgsgqvacngagavppatlveitiaanggqdyydvslvdgfnlpmsvap
qggtgeckpsscpanvnkvcpaplqvkaadgsviscksaclafgdskycctppnntpetc
ppteyseifekqcpqaysyayddknstftcsggpdyvitfcp