SCOPe 2.05: Domain d4b2cc_: 4b2c C:

Lineage for d4b2cc_ (4b2c C:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)

6. Protein Trypsin(ogen) [50515] (9 species)

7. Species Cow (Bos taurus) [TaxId:9913] [50516] (396 PDB entries)
   Uniprot P00760

8. Domain d4b2cc_: 4b2c C: [194883]
   Other proteins in same PDB: d4b2cb_, d4b2cd_
   automated match to d3plba_
   complexed with ca, cl, edo, gol

Details for d4b2cc_

PDB Entry: 4b2c, 1.43 Å

PDB Description: structure of the factor xa-like trypsin variant triple-ala (tpa) in complex with eglin c

PDB Compounds: (C:) cationic trypsin

SCOPe Domain Sequences for d4b2cc_:

Sequence; same for both SEQRES and ATOM records:

>d4b2cc_ b.47.1.2 (C:) Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]}
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsetynndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksassfiitsnmfcagyleggkdacqgdaggp
vvcsgklqgivswgsgcaqknkpgfytkvcnyvswikqtiasn

Timeline for d4b2cc_:

• d4b2cc_ first appeared in SCOPe 2.02
  
• d4b2cc_ appears in SCOPe 2.04
  
• d4b2cc_ appears in SCOPe 2.06
  
• d4b2cc_ appears in the current release, SCOPe 2.08