Lineage for d4aloa_ (4alo A:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1324198Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 1324199Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 1324200Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
    barrel, closed; n=8, S=12, meander
  6. 1324586Protein automated matches [190163] (12 species)
    not a true protein
  7. 1324587Species American lobster (Homarus americanus) [TaxId:6706] [194849] (1 PDB entry)
  8. 1324588Domain d4aloa_: 4alo A: [194851]
    automated match to d1i4ua_
    complexed with mpd, na, so4

Details for d4aloa_

PDB Entry: 4alo (more details), 2.37 Å

PDB Description: structure and properties of h1 crustacyanin from lobster homarus americanus
PDB Compounds: (A:) h1 apocrustacyanin

SCOPe Domain Sequences for d4aloa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4aloa_ b.60.1.1 (A:) automated matches {American lobster (Homarus americanus) [TaxId: 6706]}
dkipdfvvpgkcasvtrnklwaeqtpnrnmyagvwyqfaltnnpyqliekcvrneysfdg
eqfvitstgiaydgnllkrngklypnpfgephlsidyemsfaaplviletdysnyaclys
cidynfgyhsdfsfifsrsanladkyvkkceaafkninvdttrfvktvqgsscpydtqkt
v

SCOPe Domain Coordinates for d4aloa_:

Click to download the PDB-style file with coordinates for d4aloa_.
(The format of our PDB-style files is described here.)

Timeline for d4aloa_: