Lineage for d1i4ua_ (1i4u A:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1324198Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 1324199Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 1324200Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
    barrel, closed; n=8, S=12, meander
  6. 1324201Protein Alpha-crustacyanin [63807] (1 species)
  7. 1324202Species European lobster (Homarus gammarus) [TaxId:6707] [63808] (7 PDB entries)
  8. 1324203Domain d1i4ua_: 1i4u A: [61732]
    C1 subunit
    complexed with mpd, so4

Details for d1i4ua_

PDB Entry: 1i4u (more details), 1.15 Å

PDB Description: the c1 subunit of alpha-crustacyanin
PDB Compounds: (A:) crustacyanin

SCOPe Domain Sequences for d1i4ua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i4ua_ b.60.1.1 (A:) Alpha-crustacyanin {European lobster (Homarus gammarus) [TaxId: 6707]}
dkipdfvvpgkcasvdrnklwaeqtpnrnsyagvwyqfaltnnpyqliekcvrneysfdg
kqfviestgiaydgnllkrngklypnpfgephlsidyensfaaplviletdysnyaclys
cidynfgyhsdfsfifsrsanladqyvkkceaafkninvdttrfvktvqgsscpydtqkt
l

SCOPe Domain Coordinates for d1i4ua_:

Click to download the PDB-style file with coordinates for d1i4ua_.
(The format of our PDB-style files is described here.)

Timeline for d1i4ua_: