SCOPe 2.03: Domain d4ec7a_: 4ec7 A:

Lineage for d4ec7a_ (4ec7 A:)

1. Root: SCOPe 2.03

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
   disulfide-rich fold; common core is all-beta

4. Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families)

5. Family g.17.1.3: Neurotrophin [57520] (5 proteins)
   automatically mapped to Pfam PF00243

6. Protein automated matches [190424] (4 species)
   not a true protein

7. Species Chinese cobra (Naja atra) [TaxId:8656] [194713] (1 PDB entry)

8. Domain d4ec7a_: 4ec7 A: [194715]
   automated match to d1wwww_
   complexed with l44

Details for d4ec7a_

PDB Entry: 4ec7, 2.6 Å

PDB Description: Cobra NGF in complex with lipid

PDB Compounds: (A:) Venom nerve growth factor

SCOPe Domain Sequences for d4ec7a_:

Sequence; same for both SEQRES and ATOM records:

>d4ec7a_ g.17.1.3 (A:) automated matches {Chinese cobra (Naja atra) [TaxId: 8656]}
gehsvcdsvsawvtkttatdikgntvtvmenvnldnkvykeyffetkcknpnpepsgcrg
idsshwnsyctetdtfikaltmegnqaswrfirietacvcvitkkkgn

Timeline for d4ec7a_:

• d4ec7a_ first appeared in SCOPe 2.02
  
• d4ec7a_ appears in SCOPe 2.04
  
• d4ec7a_ appears in the current release, SCOPe 2.08