Lineage for d4ec7b_ (4ec7 B:)

  1. Root: SCOPe 2.03
  2. 1458801Class g: Small proteins [56992] (90 folds)
  3. 1461751Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
    disulfide-rich fold; common core is all-beta
  4. 1461752Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) (S)
  5. 1461909Family g.17.1.3: Neurotrophin [57520] (5 proteins)
    automatically mapped to Pfam PF00243
  6. 1461944Protein automated matches [190424] (4 species)
    not a true protein
  7. 1461945Species Chinese cobra (Naja atra) [TaxId:8656] [194713] (1 PDB entry)
  8. 1461947Domain d4ec7b_: 4ec7 B: [194714]
    automated match to d1wwww_
    complexed with l44

Details for d4ec7b_

PDB Entry: 4ec7 (more details), 2.6 Å

PDB Description: Cobra NGF in complex with lipid
PDB Compounds: (B:) Venom nerve growth factor

SCOPe Domain Sequences for d4ec7b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ec7b_ g.17.1.3 (B:) automated matches {Chinese cobra (Naja atra) [TaxId: 8656]}
gehsvcdsvsawvtkttatdikgntvtvmenvnldnkvykeyffetkcknpnpepsgcrg
idsshwnsyctetdtfikaltmegnqaswrfirietacvcvitkkkgn

SCOPe Domain Coordinates for d4ec7b_:

Click to download the PDB-style file with coordinates for d4ec7b_.
(The format of our PDB-style files is described here.)

Timeline for d4ec7b_: