SCOPe 2.04: Domain d4ac2b_: 4ac2 B:

Lineage for d4ac2b_ (4ac2 B:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.3: Prealbumin-like [49451] (7 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands to common fold

4. Superfamily b.3.4: Transthyretin (synonym: prealbumin) [49472] (2 families)

5. Family b.3.4.1: Transthyretin (synonym: prealbumin) [49473] (2 proteins)
   automatically mapped to Pfam PF00576

6. Protein automated matches [190376] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187223] (5 PDB entries)

8. Domain d4ac2b_: 4ac2 B: [194653]
   automated match to d1ttaa_
   complexed with 43f

Details for d4ac2b_

PDB Entry: 4ac2, 1.81 Å

PDB Description: crystal structure of transthyretin in complex with ligand c-7

PDB Compounds: (B:) Transthyretin

SCOPe Domain Sequences for d4ac2b_:

Sequence; same for both SEQRES and ATOM records:

>d4ac2b_ b.3.4.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtn

Timeline for d4ac2b_:

• d4ac2b_ first appeared in SCOPe 2.02
  
• d4ac2b_ appears in SCOPe 2.03
  
• d4ac2b_ appears in SCOPe 2.05
  
• d4ac2b_ appears in the current release, SCOPe 2.08