Lineage for d4fd8a_ (4fd8 A:)

  1. Root: SCOPe 2.07
  2. 2618030Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2618349Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 2618350Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 2618351Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 2618634Protein beta-Lactamase, class A [56606] (16 species)
  7. 2618824Species Klebsiella pneumoniae, SHV-1 [TaxId:573] [56609] (27 PDB entries)
    inhibited by tazobactam
    Uniprot Q5PSW7 ! Uniprot P14557 22-286
  8. 2618832Domain d4fd8a_: 4fd8 A: [194637]
    automated match to d1onga_
    complexed with ma4

Details for d4fd8a_

PDB Entry: 4fd8 (more details), 1.52 Å

PDB Description: Structure of apo S70C SHV beta-lactamase
PDB Compounds: (A:) Beta-lactamase SHV-1

SCOPe Domain Sequences for d4fd8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fd8a_ e.3.1.1 (A:) beta-Lactamase, class A {Klebsiella pneumoniae, SHV-1 [TaxId: 573]}
spqpleqiklsesqlsgrvgmiemdlasgrtltawraderfpmmctfkvvlcgavlarvd
agdeqlerkihyrqqdlvdyspvsekhladgmtvgelcaaaitmsdnsaanlllatvggp
agltaflrqigdnvtrldrwetelnealpgdardtttpasmaatlrklltsqrlsarsqr
qllqwmvddrvagplirsvlpagwfiadktgagergargivallgpnnkaerivviylrd
tpasmaernqqiagigaaliehwqr

SCOPe Domain Coordinates for d4fd8a_:

Click to download the PDB-style file with coordinates for d4fd8a_.
(The format of our PDB-style files is described here.)

Timeline for d4fd8a_: