Lineage for d4b1ca_ (4b1c A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1796116Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 1796117Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 1797457Family b.50.1.2: Pepsin-like [50646] (11 proteins)
    duplication: consists of two similar barrel domains
    N-terminal: barrel, partly opened; n*=6, S*=10
  6. 1798215Protein automated matches [190156] (4 species)
    not a true protein
  7. 1798240Species Human (Homo sapiens) [TaxId:9606] [187237] (38 PDB entries)
  8. 1798259Domain d4b1ca_: 4b1c A: [194565]
    automated match to d1fkna_
    complexed with 1b1, dms

Details for d4b1ca_

PDB Entry: 4b1c (more details), 1.95 Å

PDB Description: new aminoimidazoles as bace-1 inhibitors: from rational design to ab- lowering in brain
PDB Compounds: (A:) Beta-secretase 1

SCOPe Domain Sequences for d4b1ca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4b1ca_ b.50.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kkgsfvemvdnlrgksgqgyyvemtvgsppqtlnilvdtgssnfavgaaphpflhryyqr
qlsstyrdlrkgvyvpytqgkwegelgtdlvsiphgpnvtvraniaaitesdkffingsn
wegilglayaeiarpddslepffdslvkqthvpnlfslqlcgggsmiiggidhslytgsl
wytpirrewyyeviivrveingqdlkmdckeynydksivdsgttnlrlpkkvfeaavksi
kaasstekfpdgfwlgeqlvcwqagttpwnifpvislylmgevtnqsfritilpqqylrp
vedvatsqddcykfaisqsstgtvmgavimegfyvvfdrarkrigfavsachvhdefrta
avegpfvtledcgyn

SCOPe Domain Coordinates for d4b1ca_:

Click to download the PDB-style file with coordinates for d4b1ca_.
(The format of our PDB-style files is described here.)

Timeline for d4b1ca_: