SCOPe 2.02: Domain d4gtla_: 4gtl A:

Lineage for d4gtla_ (4gtl A:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.207: Thymidylate synthase-complementing protein Thy1 [69795] (1 superfamily)
   complex alpha+beta fold; contains antiparallel 5-stranded beta-sheet: order 12354

4. Superfamily d.207.1: Thymidylate synthase-complementing protein Thy1 [69796] (1 family)

5. Family d.207.1.1: Thymidylate synthase-complementing protein Thy1 [69797] (2 proteins)

6. Protein automated matches [191028] (2 species)
   not a true protein

7. Species Thermotoga maritima [TaxId:243274] [188837] (6 PDB entries)

8. Domain d4gtla_: 4gtl A: [194504]
   automated match to d1o2ab_
   complexed with fad; mutant

Details for d4gtla_

PDB Entry: 4gtl, 2.17 Å

PDB Description: t. maritima fdts (r174k mutant) with fad

PDB Compounds: (A:) Thymidylate synthase thyX

SCOPe Domain Sequences for d4gtla_:

Sequence, based on SEQRES records:

>d4gtla_ d.207.1.1 (A:) automated matches {Thermotoga maritima [TaxId: 243274]}
hhhmkidildkgfvelvdvmgndlsavraarvsfdmglkdeerdrhlieylmkhghetpf
ehivftfhvkapifvarqwfrhriasynelsgrysklsyefyipsperlegykttipper
vtekiseivdkayrtyleliesgvprevarivlplnlytrffwtvnarslmnflnlkads
haqweiqqyalaiarifkekcpwtfeaflkyaykgdilke

Sequence, based on observed residues (ATOM records):

>d4gtla_ d.207.1.1 (A:) automated matches {Thermotoga maritima [TaxId: 243274]}
hhhmkidildkgfvelvdvmgndlsavraarvsfdmdeerdrhlieylmkhghetpfehi
vftfhvkapifvarqwfrhriasynelsrysklsyefyipsperlegykttippervtek
iseivdkayrtyleliesgvprevarivlplnlytrffwtvnarslmnflnlkadshaqw
eiqqyalaiarifkekcpwtfeaflkyaykgdilke

Timeline for d4gtla_:

• d4gtla_ is new in SCOPe 2.02-stable
  
• d4gtla_ appears in SCOPe 2.03
  
• d4gtla_ appears in the current release, SCOPe 2.08, called d4gtla1