Lineage for d4h9ra_ (4h9r A:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1082620Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 1082621Superfamily a.22.1: Histone-fold [47113] (4 families) (S)
  5. 1082622Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 1083052Protein automated matches [193445] (1 species)
    not a true protein
  7. 1083053Species Homo sapiens [TaxId:9606] [193446] (12 PDB entries)
  8. 1083057Domain d4h9ra_: 4h9r A: [194491]
    Other proteins in same PDB: d4h9rb_
    automated match to d1kx5a_
    protein/DNA complex; complexed with po4

Details for d4h9ra_

PDB Entry: 4h9r (more details), 2.2 Å

PDB Description: Complex structure 5 of DAXX(E225A)/H3.3(sub5,G90A)/H4
PDB Compounds: (A:) Histone H3.3

SCOPe Domain Sequences for d4h9ra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4h9ra_ a.22.1.1 (A:) automated matches {Homo sapiens [TaxId: 9606]}
kphryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqsaaiaalqeaa
eaflvalfedtnlctihakrvtifpkdiqlarrirger

SCOPe Domain Coordinates for d4h9ra_:

Click to download the PDB-style file with coordinates for d4h9ra_.
(The format of our PDB-style files is described here.)

Timeline for d4h9ra_: