SCOPe 2.02: Domain d4h9ra_: 4h9r A:

Lineage for d4h9ra_ (4h9r A:)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.22: Histone-fold [47112] (1 superfamily)
   core: 3 helices; long middle helix is flanked at each end with shorter ones

4. Superfamily a.22.1: Histone-fold [47113] (4 families)

5. Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
   form octamers composed of two copies of each of the four histones

6. Protein automated matches [193445] (1 species)
   not a true protein

7. Species Homo sapiens [TaxId:9606] [193446] (12 PDB entries)

8. Domain d4h9ra_: 4h9r A: [194491]
   Other proteins in same PDB: d4h9rb_
   automated match to d1kx5a_
   protein/DNA complex; complexed with po4

Details for d4h9ra_

PDB Entry: 4h9r, 2.2 Å

PDB Description: Complex structure 5 of DAXX(E225A)/H3.3(sub5,G90A)/H4

PDB Compounds: (A:) Histone H3.3

SCOPe Domain Sequences for d4h9ra_:

Sequence; same for both SEQRES and ATOM records:

>d4h9ra_ a.22.1.1 (A:) automated matches {Homo sapiens [TaxId: 9606]}
kphryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqsaaiaalqeaa
eaflvalfedtnlctihakrvtifpkdiqlarrirger

Timeline for d4h9ra_:

• d4h9ra_ is new in SCOPe 2.02-stable
  
• d4h9ra_ appears in SCOPe 2.03
  
• d4h9ra_ appears in the current release, SCOPe 2.08