![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.128: Terpenoid synthases [48575] (1 superfamily) multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers |
![]() | Superfamily a.128.1: Terpenoid synthases [48576] (6 families) ![]() duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J |
![]() | Family a.128.1.3: Terpenoid cyclase C-terminal domain [48583] (3 proteins) automatically mapped to Pfam PF03936 |
![]() | Protein 5-Epi-aristolochene synthase [48584] (1 species) |
![]() | Species Tobacco (Nicotiana tabacum) [TaxId:4097] [48585] (7 PDB entries) |
![]() | Domain d5easa2: 5eas A:221-548 [19444] Other proteins in same PDB: d5easa1 complexed with mg |
PDB Entry: 5eas (more details), 2.25 Å
SCOPe Domain Sequences for d5easa2:
Sequence, based on SEQRES records: (download)
>d5easa2 a.128.1.3 (A:221-548) 5-Epi-aristolochene synthase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} knnvllrfakldfnllqmlhkqelaqvsrwwkdldfvttlpyardrvvecyfwalgvyfe pqysqarvmlvktismisivddtfdaygtvkeleaytdaiqrwdineidrlpdymkisyk aildlykdyekelssagrshivchaiermkevvrnynvestwfiegytppvseylsnala tttyyylattsylgmksateqdfewlsknpkileasviicrviddtatyeveksrgqiat gieccmrdygistkeamakfqnmaetawkdinegllrptpvstefltpilnlarivevty ihnldgythpekvlkphiinllvdsiki
>d5easa2 a.128.1.3 (A:221-548) 5-Epi-aristolochene synthase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} knnvllrfakldfnllqmlhkqelaqvsrwwkdldfvttlpyardrvvecyfwalgvyfe pqysqarvmlvktismisivddtfdaygtvkeleaytdaiqrwdineidrlpdymkisyk aildlykdyekelssagrshivchaiermkevvrnynvestwfiegytppvseylsnala tttyyylattsylgmksateqdfewlsknpkileasviicrviddtatyeveksrgqiat gieccmrdygistkeamakfqnmaetawkdinegllrptpvstefltpilnlarivevty ivlkphiinllvdsiki
Timeline for d5easa2: