SCOPe 2.02: Domain d3v4yg_: 3v4y G:

Lineage for d3v4yg_ (3v4y G:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
   4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication

4. Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families)
   different families of this superfamily are groupped in a single Pfam family, Pfam PF00149

5. Family d.159.1.3: Protein serine/threonine phosphatase [56310] (6 proteins)

6. Protein automated matches [190344] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187171] (6 PDB entries)

8. Domain d3v4yg_: 3v4y G: [194380]
   automated match to d1fjma_
   complexed with 15p, gol, mn

Details for d3v4yg_

PDB Entry: 3v4y, 2.1 Å

PDB Description: Crystal Structure of the first Nuclear PP1 holoenzyme

PDB Compounds: (G:) Serine/threonine-protein phosphatase PP1-alpha catalytic subunit

SCOPe Domain Sequences for d3v4yg_:

Sequence; same for both SEQRES and ATOM records:

>d3v4yg_ d.159.1.3 (G:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ghmgslnldsiigrllevqgsrpgknvqlteneirglclksreiflsqpilleleaplki
cgdihgqyydllrlfeyggfppesnylflgdyvdrgkqsleticlllaykikypenffll
rgnhecasinriygfydeckrryniklwktftdcfnclpiaaivdekifcchgglspdlq
smeqirrimrptdvpdqgllcdllwsdpdkdvqgwgendrgvsftfgaevvakflhkhdl
dlicrahqvvedgyeffakrqlvtlfsapnycgefdnagammsvdetlmcsfqilkp

Timeline for d3v4yg_:

• d3v4yg_ is new in SCOPe 2.02-stable
  
• d3v4yg_ appears in SCOPe 2.03
  
• d3v4yg_ appears in the current release, SCOPe 2.08, called d3v4yg1