SCOPe 2.08: Domain d3v4yc1: 3v4y C:7-300

Lineage for d3v4yc1 (3v4y C:7-300)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
   4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication

4. Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families)
   different families of this superfamily are groupped in a single Pfam family, Pfam PF00149

5. Family d.159.1.3: Protein serine/threonine phosphatase [56310] (6 proteins)

6. Protein automated matches [190344] (6 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187171] (10 PDB entries)

8. Domain d3v4yc1: 3v4y C:7-300 [194377]
   Other proteins in same PDB: d3v4yc2, d3v4yg2
   automated match to d1fjma_
   complexed with 15p, gol, mn

Details for d3v4yc1

PDB Entry: 3v4y, 2.1 Å

PDB Description: Crystal Structure of the first Nuclear PP1 holoenzyme

PDB Compounds: (C:) Serine/threonine-protein phosphatase PP1-alpha catalytic subunit

SCOPe Domain Sequences for d3v4yc1:

Sequence; same for both SEQRES and ATOM records:

>d3v4yc1 d.159.1.3 (C:7-300) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lnldsiigrllevqgsrpgknvqlteneirglclksreiflsqpilleleaplkicgdih
gqyydllrlfeyggfppesnylflgdyvdrgkqsleticlllaykikypenffllrgnhe
casinriygfydeckrryniklwktftdcfnclpiaaivdekifcchgglspdlqsmeqi
rrimrptdvpdqgllcdllwsdpdkdvqgwgendrgvsftfgaevvakflhkhdldlicr
ahqvvedgyeffakrqlvtlfsapnycgefdnagammsvdetlmcsfqilkpad

Timeline for d3v4yc1:

• d3v4yc1 first appeared in SCOPe 2.02, called d3v4yc_
  
• d3v4yc1 appears in SCOPe 2.07