Lineage for d3vtsa_ (3vts A:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3032122Fold g.7: Snake toxin-like [57301] (1 superfamily)
    disulfide-rich fold: nearly all-beta
  4. 3032123Superfamily g.7.1: Snake toxin-like [57302] (4 families) (S)
  5. 3032124Family g.7.1.1: Snake venom toxins [57303] (28 proteins)
    automatically mapped to Pfam PF00087
  6. 3032326Protein automated matches [190676] (9 species)
    not a true protein
  7. 3032335Species Hemachatus haemachatus [TaxId:8626] [194346] (1 PDB entry)
  8. 3032336Domain d3vtsa_: 3vts A: [194348]
    automated match to d1h0ja_

Details for d3vtsa_

PDB Entry: 3vts (more details), 2.43 Å

PDB Description: Crystal structure of a three finger toxin from snake venom
PDB Compounds: (A:) Cytotoxin 1

SCOPe Domain Sequences for d3vtsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vtsa_ g.7.1.1 (A:) automated matches {Hemachatus haemachatus [TaxId: 8626]}
lkchnklvpflsktcpegknlcykmtlmkmpkipikrgctdacpkssllvkvvccnkdkc
n

SCOPe Domain Coordinates for d3vtsa_:

Click to download the PDB-style file with coordinates for d3vtsa_.
(The format of our PDB-style files is described here.)

Timeline for d3vtsa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3vtsb_