![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.7: Snake toxin-like [57301] (1 superfamily) disulfide-rich fold: nearly all-beta |
![]() | Superfamily g.7.1: Snake toxin-like [57302] (4 families) ![]() |
![]() | Family g.7.1.1: Snake venom toxins [57303] (28 proteins) automatically mapped to Pfam PF00087 |
![]() | Protein automated matches [190676] (9 species) not a true protein |
![]() | Species Hemachatus haemachatus [TaxId:8626] [194346] (1 PDB entry) |
![]() | Domain d3vtsa_: 3vts A: [194348] automated match to d1h0ja_ |
PDB Entry: 3vts (more details), 2.43 Å
SCOPe Domain Sequences for d3vtsa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3vtsa_ g.7.1.1 (A:) automated matches {Hemachatus haemachatus [TaxId: 8626]} lkchnklvpflsktcpegknlcykmtlmkmpkipikrgctdacpkssllvkvvccnkdkc n
Timeline for d3vtsa_: