Class b: All beta proteins [48724] (176 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins) |
Protein automated matches [190044] (14 species) not a true protein |
Species Jararacussu (Bothrops jararacussu) [TaxId:8726] [194232] (1 PDB entry) |
Domain d4gsoa_: 4gso A: [194233] automated match to d1op2a_ |
PDB Entry: 4gso (more details), 2.6 Å
SCOPe Domain Sequences for d4gsoa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4gsoa_ b.47.1.2 (A:) automated matches {Jararacussu (Bothrops jararacussu) [TaxId: 8726]} vlggdecdinehpflaflyshgyfcgltlinqewvvtaahcdstnfqmqlgvhskkvlne deqtrnpkekficpnknmsevldkdimlikldkpisnskhiaplslpsnppsvgsvcrim gwgsitipnetypdvpycaninlvdyevcqgaynglpakttlcagvleggkdtcvgdsgg plicngqfqgivsygahscgqgpkpgiytnvfdytdwiqrniagntdatcpp
Timeline for d4gsoa_: