Lineage for d4agja_ (4agj A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1793083Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 1793084Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 1795140Family b.47.1.3: Viral proteases [50596] (5 proteins)
    beta sheet in the first domain is opened rather than forms a barrel
  6. 1795230Protein automated matches [190658] (4 species)
    not a true protein
  7. 1795231Species Aura virus [TaxId:44158] [194195] (3 PDB entries)
  8. 1795233Domain d4agja_: 4agj A: [194196]
    automated match to d2snwa_
    complexed with dio

Details for d4agja_

PDB Entry: 4agj (more details), 1.98 Å

PDB Description: crystal structure of the capsid protein (110-267) from aura virus in complex with dioxane
PDB Compounds: (A:) capsid protein

SCOPe Domain Sequences for d4agja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4agja_ b.47.1.3 (A:) automated matches {Aura virus [TaxId: 44158]}
drtfavknedgkimgyavamegkvikplhvkgtidhpalaklkftksssydmefaklpte
mksdafgyttehpegfynwhhgavqfsggrftiptgaggpgdsgrpilddsgkvvaivlg
ganegartalsvvtwnkkgaaiktthedtvew

SCOPe Domain Coordinates for d4agja_:

Click to download the PDB-style file with coordinates for d4agja_.
(The format of our PDB-style files is described here.)

Timeline for d4agja_: