Lineage for d4hbna1 (4hbn A:521-719)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2814470Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2816658Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families) (S)
  5. 2816664Family b.82.3.2: cAMP-binding domain [51210] (13 proteins)
    Pfam PF00027
  6. 2816817Protein automated matches [190352] (10 species)
    not a true protein
  7. 2816845Species Human (Homo sapiens) [TaxId:9606] [189505] (8 PDB entries)
  8. 2816850Domain d4hbna1: 4hbn A:521-719 [194138]
    Other proteins in same PDB: d4hbna2
    automated match to d3u11b_
    complexed with cmp, po4; mutant

Details for d4hbna1

PDB Entry: 4hbn (more details), 2.6 Å

PDB Description: Crystal structure of the human HCN4 channel C-terminus carrying the S672R mutation
PDB Compounds: (A:) Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 4

SCOPe Domain Sequences for d4hbna1:

Sequence, based on SEQRES records: (download)

>d4hbna1 b.82.3.2 (A:521-719) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dssrrqyqekykqveqymsfhklppdtrqrihdyyehryqgkmfdeesilgelseplree
iinfncrklvasmplfanadpnfvtsmltklrfevfqpgdyiiregtigkkmyfiqhgvv
svltkgnketkladgsyfgeiclltrgrrtarvradtycrlyslsvdnfnevleeypmmr
rafetvaldrldrigkkns

Sequence, based on observed residues (ATOM records): (download)

>d4hbna1 b.82.3.2 (A:521-719) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dssrrqyqekykqveqymsfhklppdtrqrihdyyehryqgkmfdeesilgelseplree
iinfncrklvasmplfanadpnfvtsmltklrfevfqpgdyiiregtigkkmyfiqhgvv
svltgnketkladgsyfgeiclltrgrrtarvradtycrlyslsvdnfnevleeypmmrr
afetvaldrldrigkkns

SCOPe Domain Coordinates for d4hbna1:

Click to download the PDB-style file with coordinates for d4hbna1.
(The format of our PDB-style files is described here.)

Timeline for d4hbna1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4hbna2