PDB entry 4hbn

View 4hbn on RCSB PDB site
Description: Crystal structure of the human HCN4 channel C-terminus carrying the S672R mutation
Class: neuropeptide
Keywords: cAMP binding, cAMP, NEUROPEPTIDE
Deposited on 2012-09-28, released 2013-01-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-01-16, with a file datestamp of 2013-01-11.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.259
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 4
    Species: Homo sapiens [TaxId:9606]
    Gene: HCN4
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Y3Q4 (1-End)
      • expression tag (0)
      • engineered mutation (152)
    Domains in SCOPe 2.07: d4hbna1, d4hbna2
  • Heterogens: CMP, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4hbnA (A:)
    sdssrrqyqekykqveqymsfhklppdtrqrihdyyehryqgkmfdeesilgelseplre
    eiinfncrklvasmplfanadpnfvtsmltklrfevfqpgdyiiregtigkkmyfiqhgv
    vsvltkgnketkladgsyfgeiclltrgrrtarvradtycrlyslsvdnfnevleeypmm
    rrafetvaldrldrigkknsillhk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hbnA (A:)
    sdssrrqyqekykqveqymsfhklppdtrqrihdyyehryqgkmfdeesilgelseplre
    eiinfncrklvasmplfanadpnfvtsmltklrfevfqpgdyiiregtigkkmyfiqhgv
    vsvltgnketkladgsyfgeiclltrgrrtarvradtycrlyslsvdnfnevleeypmmr
    rafetvaldrldrigkkns