Lineage for d4b8zc_ (4b8z C:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1346342Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1346343Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1349962Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 1349963Protein automated matches [190069] (159 species)
    not a true protein
  7. 1350556Species Human (Homo sapiens) [TaxId:9606] [186944] (28 PDB entries)
  8. 1350646Domain d4b8zc_: 4b8z C: [194048]
    automated match to d1bsva_
    complexed with gdp, nap

Details for d4b8zc_

PDB Entry: 4b8z (more details), 2.75 Å

PDB Description: crystal structure of human gdp-l-fucose synthase with bound nadp and gdp, rhombohedral crystal form
PDB Compounds: (C:) GDP-l-fucose synthase

SCOPe Domain Sequences for d4b8zc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4b8zc_ c.2.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mrilvtggsglvgkaiqkvvadgaglpgedwvfvsskdadltdtaqtralfekvqpthvi
hlaamvgglfrnikynldfwrknvhmndnvlhsafevgarkvvsclstcifpdkttypid
etmihngpphnsnfgysyakrmidvqnrayfqqygctftaviptnvfgphdnfniedghv
lpglihkvhlakssgsaltvwgtgnprrqfiysldlaqlfiwvlreynevepiilsvgee
devsikeaaeavveamdfhgevtfdttksdgqfkktasnsklrtylpdfrftpfkqavke
tcawftdnyeqar

SCOPe Domain Coordinates for d4b8zc_:

Click to download the PDB-style file with coordinates for d4b8zc_.
(The format of our PDB-style files is described here.)

Timeline for d4b8zc_: