SCOPe 2.05: Domain d4do2a_: 4do2 A:

Lineage for d4do2a_ (4do2 A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.30: ROP-like [47379] (8 superfamilies)
   4 helices; dimer of identical alpha-hairpin subunits; bundle, closed, left-handed twist

4. Superfamily a.30.1: ROP protein [47380] (1 family)
   automatically mapped to Pfam PF01815

5. Family a.30.1.1: ROP protein [47381] (1 protein)

6. Protein ROP protein [47382] (1 species)

7. Species Escherichia coli [TaxId:562] [47383] (17 PDB entries)
   Uniprot P03051

8. Domain d4do2a_: 4do2 A: [194014]
   automated match to d1rpra_
   mutant

Details for d4do2a_

PDB Entry: 4do2, 1.4 Å

PDB Description: Crystal Structure of the Rop protein mutant D30P/A31G at resolution 1.4 resolution.

PDB Compounds: (A:) Regulatory protein rop

SCOPe Domain Sequences for d4do2a_:

Sequence; same for both SEQRES and ATOM records:

>d4do2a_ a.30.1.1 (A:) ROP protein {Escherichia coli [TaxId: 562]}
mtkqektalnmarfirsqtltlleklnelpgdeqadiceslhdhadelyrsclarfg

Timeline for d4do2a_:

• d4do2a_ first appeared in SCOPe 2.02
  
• d4do2a_ appears in SCOPe 2.04
  
• d4do2a_ appears in SCOPe 2.06
  
• d4do2a_ appears in the current release, SCOPe 2.08