SCOPe 2.02: Domain d3vpea_: 3vpe A:

Lineage for d3vpea_ (3vpe A:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
   duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets

4. Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families)

5. Family d.157.1.0: automated matches [191360] (1 protein)
   not a true family

6. Protein automated matches [190418] (5 species)
   not a true protein

7. Species Serratia marcescens [TaxId:615] [193993] (2 PDB entries)

8. Domain d3vpea_: 3vpe A: [193994]
   automated match to d2gmna1
   complexed with act, gol, so4, zn

Details for d3vpea_

PDB Entry: 3vpe, 1.6 Å

PDB Description: Crystal Structure of Metallo-beta-Lactamase SMB-1

PDB Compounds: (A:) metallo-beta-lactamase

SCOPe Domain Sequences for d3vpea_:

Sequence; same for both SEQRES and ATOM records:

>d3vpea_ d.157.1.0 (A:) automated matches {Serratia marcescens [TaxId: 615]}
rdwsspqqpftiygnthyvgtggisavllsspqghilvdgttekgaqvvaaniramgfkl
sdvkyilsthshedhaggisamqkltgatvlagaanvdtlrtgvspksdpqfgslsnfpg
sakvravadgelvklgplavkahatpghteggitwtwqsceqgkckdvvfadsltavsad
syrfsdhpevvaslrgsfeaveklscdiaiaahpevndmwtrqqraakegnsayvdngac
raiaaagrkrletrlasek

Timeline for d3vpea_:

• d3vpea_ is new in SCOPe 2.02-stable
  
• d3vpea_ appears in SCOPe 2.03
  
• d3vpea_ appears in the current release, SCOPe 2.08